Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 169 (Tmem169)

This Recombinant Mouse Transmembrane protein 169 (Tmem169) spans the amino acid sequence from region 1-297.

Product Specifications

Product Name Alternative

Transmembrane protein 169

UniProt

Q8BG50

Expression Region

1-297

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEESAPVESQGQLPSPHHGSLRRAVAAVLALDGESTLGRRKKRRKDSRPESIIIYRSDNE KTDEEPEESEGGDRPKEEEGEDFLDYPGDDGVWNMPLDSRYVTLTGTITRGKKKGQMVDI HVTLTEKELQELTKPKELSREAAPEGRRACQVGADQGPHVVLWTLVCLPVVFVLSFVVSF YYGTITWYNIFLVYNEERTFWHKISCCPCLILFYPVLIMTMASSLGLYAAVAQLSWSWAA WWRAACDMEKGFCGWLCSKLGLEDCSPYSIVELLESDNISGNLSNKDPIQEVETSTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C16orf88 (KNOP1) Rabbit Polyclonal Antibody
TA372140 100 µL

C16orf88 (KNOP1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STAT1 Rabbit Polyclonal Antibody
TA385328 100 µL

STAT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Parvo B19 TaqMan PCR Kit Dx
DxTM39600 24 Reactions

Parvo B19 TaqMan PCR Kit Dx

Sign In for Pricing
View Details
DDX6 (NM_004397) Human Over-expression Lysate
LY401399 100 µg

DDX6 (NM_004397) Human Over-expression Lysate

Sign In for Pricing
View Details
Brivaracetam-d7 (Mixture of Diastereomers)
TRC-B677648-1MG 1 mg

Brivaracetam-d7 (Mixture of Diastereomers)

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS705932 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details