Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cryphonectria parasitica mycoreovirus 1 Uncharacterized protein VP9 (S9)

This Recombinant Cryphonectria parasitica mycoreovirus 1 Uncharacterized protein VP9 (S9) spans the amino acid sequence from region 1-297.

Product Specifications

Product Name Alternative

Uncharacterized protein VP9

UniProt

Q65YU7

Expression Region

1-297

Origin

Cryphonectria parasitica mycoreovirus 1 (strain 9B21) (CpMYRV-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFTVVGSNIYDTTLLMTRKGQNGAPDEVIPRPGFLTLLLNDIDSLRTRVELHNLIDNLN LATNEDYVKFAEYRTLFSQTTDMIRLAYTNGQPAVQTRATDSRTGSVFYANTLTGDKAGN LFRLLAPIAYRYLDVGLPRLFSYIHAQIGTTPAFRYNFDIQPIIKLAITNEPLDYGEWIG QEGIHELERNVMIILSCSNITILAVLSIVGLGVGSHIMTSAADQEAWVGSPFMLSTDNFG NARPFTAPNPSYAQTLRLPIPRIFSAPNRPVWVQSKTSETQSVSGSTHSDEKLTAPM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mix-n-StainTM CF®405L Antibody Labeling Kit, 3x (5-20ug) labeling
#92445 1 Kit

Mix-n-StainTM CF®405L Antibody Labeling Kit, 3x (5-20ug) labeling

Sign In for Pricing
View Details
Recombinant Mouse CD64/FCGR1 Protein (His Tag)
PKSM041015-01 10 µg

Recombinant Mouse CD64/FCGR1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse CD64/FCGR1 Protein (His Tag)
PKSM041015-02 50 µg

Recombinant Mouse CD64/FCGR1 Protein (His Tag)

Sign In for Pricing
View Details
Human IL-1β (Interleukin 1 Beta) CLIA Kit
E-CL-H0141-01 24 Tests

Human IL-1β (Interleukin 1 Beta) CLIA Kit

Sign In for Pricing
View Details
Human IL-1β (Interleukin 1 Beta) CLIA Kit
E-CL-H0141-02 48 Tests

Human IL-1β (Interleukin 1 Beta) CLIA Kit

Sign In for Pricing
View Details
Human IL-1β (Interleukin 1 Beta) CLIA Kit
E-CL-H0141-03 96 Tests

Human IL-1β (Interleukin 1 Beta) CLIA Kit

Sign In for Pricing
View Details