Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Bacteriophage T4 late gene expression-blocking protein (lit)

This Recombinant Escherichia coli Bacteriophage T4 late gene expression-blocking protein (lit) spans the amino acid sequence from region 1-297.

Product Specifications

Product Name Alternative

Bacteriophage T4 late gene expression-blocking protein, GpLit

UniProt

P11072

Expression Region

1-297

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRSPICHLFSAINSSPFKIAPEKEQDLKTIVDDKKIIISVVSEPGFNIRVRKNESNNSHE IVLTVASLEYIWAFSNFFWVFTQEYSKSQKNNDEHFDLTGKNRLKKSDELLKWARKNLQT TGCESWPKKCPKPEAYLQGSEDSQVASEIFLCAIAWILHHEISHVVLQHPLVTTAFSTQE EREADSHATKWILGNLYESAPELKKRALGIATAVLCIQSLEVENYFCLQNTHPAAYERIY SNISCYPVGNEELIEALCTVMLQYLFHGKNINVNLDGESFSSILGDLLCDISRLTSN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD46 (122.2), CF594 conjugate, 0.1mg/mL
BNC940175-100 1x 100 µL

CD46 (122.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL
BNC680965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL
BNC740146-500 1x 500 µL

CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (HJ21), CF568 conjugate, 0.1mg/mL
BNC680984-100 1x 100 µL

P21 / WAF1 (HJ21), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1620), CF740 conjugate, 0.1mg/mL
BNC741620-500 1x 500 µL

CD10 (Membrane Metalloendopeptidase) (MME/1620), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-H) (NF421), CF647 conjugate, 0.1mg/mL
BNC470421-500 1x 500 µL

Neurofilament (NF-H) (NF421), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details