Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human respiratory syncytial virus A Major surface glycoprotein G (G)

This Recombinant Human respiratory syncytial virus A Major surface glycoprotein G (G) spans the amino acid sequence from region 1-297.

Product Specifications

Product Name Alternative

Major surface glycoprotein G, Attachment glycoprotein G, Membrane-bound glycoprotein, mG

UniProt

P27023

Expression Region

1-297

Origin

Human respiratory syncytial virus A (strain rsb5857)

Field of Research

Infectious Disease & Virology; Respiratory Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKTKDQRTAKTLERTWDTLNHLLFISSCLYKLNLKSIAQITLSILAMIISTSLIIAAII FIASANHKVTLTTAIIQDATSQIKNTTQTYLTQNTQLGISFSNLSETTSQPTTTPALTTP SAKSTPQSTTVKTKNTTTTQIQPSKPTTKQRQKKPPNKPNNDFHFEVFNFVPCSICSNNP TCWAICKRIPNKKPGKKTTTKPTKKPTIKTTKKDLKPQTTKPKEVLTTKPTEKPTINTTR TNIRTTLLTTNTTGNPEYTSQKETLHSTSPEGNPSPSQVYTTSEYPSQPPSPSNTTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD34 (ICO-115), CF568 conjugate, 0.1mg/mL
BNC680039-100 1x 100 µL

CD34 (ICO-115), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF405S conjugate, 0.1mg/mL
BNC040676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (rIGHG4/1345), CF488A conjugate, 0.1mg/mL
BNC882284-100 1x 100 µL

Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (rIGHG4/1345), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BOB.1 (B-Cell Marker) (BOB1/2424), CF405S conjugate, 0.1mg/mL
BNC042424-100 1x 100 µL

BOB.1 (B-Cell Marker) (BOB1/2424), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2136), CF640R conjugate, 0.1mg/mL
BNC402136-100 1x 100 µL

OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2136), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX10 (SOX10/991 + SOX10/1074), CF740 conjugate, 0.1mg/mL
BNC741074-100 1x 100 µL

SOX10 (SOX10/991 + SOX10/1074), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details