Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cholesterol 25-hydroxylase (Ch25h)

This Recombinant Mouse Cholesterol 25-hydroxylase (Ch25h) spans the amino acid sequence from region 1-298aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cholesterol 25-monooxygenase (m25OH)

UniProt

Q9Z0F5

Expression Region

1-298aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.2 kDa

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGCYNGSELQDLGCSSQLLLQPLWDTIRTREAFTRSPIFPVTFSIITYVGFCLPFVVLDVLYPWVPILRRYKIHPDFSPSVKQLLPCLGLTLYQHLVFVFPVTLLHWVRSPALLPQEAPELVQLLSHVLICLLLFDTEIFAWHLLHHKVPWLYRTFHKVHHQNSSSFALATQYMSFWELLSLTFFDVLNVAVLRCHPLTIFTFHVINIWLSVEDHSGYDFPWSTHRLVPFGWYGGVAHHDMHHSQFNCNFAPYFTHWDKMLGTLRSAPLPESLCACGERCVNSRERCAVHLIQKKKQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP8, FLAG-tag
80358 50 µg

USP8, FLAG-tag

Sign In for Pricing
View Details
p114RhoGEF (ARHGEF18) Mouse Monoclonal Antibody [Clone ID: OTI6G8]
CF810295 100 µg

p114RhoGEF (ARHGEF18) Mouse Monoclonal Antibody [Clone ID: OTI6G8]

Sign In for Pricing
View Details
Rabbit Polyclonal TMEM34 Antibody [DyLight 350]
NBP1-77144UV 0.1 mL

Rabbit Polyclonal TMEM34 Antibody [DyLight 350]

Sign In for Pricing
View Details
ZNF174 Antibody - N-terminal region
P100902_T100-25UL 25 µL

ZNF174 Antibody - N-terminal region

Sign In for Pricing
View Details
CABLES2 Polyclonal Antibody, Cy5 Conjugated
bs-5744R-Cy5 100 µL

CABLES2 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Recombinant Reelin (RELN)
MBS2123009-01 0.01 mg

Recombinant Reelin (RELN)

Sign In for Pricing
View Details