Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Competence regulatory protein ComQ (comQ)

This Recombinant Bacillus subtilis Competence regulatory protein ComQ (comQ) spans the amino acid sequence from region 1-299.

Product Specifications

Product Name Alternative

Competence regulatory protein ComQ

UniProt

P33690

Expression Region

1-299

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKEIVEQNIFNEDLSQLLYSFIDSKETFSFAESTILHYVVFGGENLDVATRLGAGIEILI LSSDIMDDLEDEDNHHALWMKINRSESLNAALSLYTVGLTSIYSLNNNPLIFKYVLKYVN EAMQGQHDDITNKSKTEDESLEVIRLKCGSLIALANVAGVLLATGEYNETVERYSYYKGI IAQISGDYYVLLSGNRSDIEKNKHTLIYLYLKRLFNDASEDLLYLISHKDLYYKSLLDKE KFQEKLIKAGVTQYISVLLEIYKQKCISAIEQLNLDKEKKELIKECLLSYTKGDTRCKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARHGEF39 Rabbit Polyclonal Antibody
TA333601 100 µL

ARHGEF39 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Contactin 4 (CNTN4) ELISA Kit
abx252238-01 96 Tests

Human Contactin 4 (CNTN4) ELISA Kit

Sign In for Pricing
View Details
Human Contactin 4 (CNTN4) ELISA Kit
abx252238-02 5x 96 Tests

Human Contactin 4 (CNTN4) ELISA Kit

Sign In for Pricing
View Details
Human Contactin 4 (CNTN4) ELISA Kit
abx252238-03 10x 96 Tests

Human Contactin 4 (CNTN4) ELISA Kit

Sign In for Pricing
View Details
TIMELESS Polyclonal Antibody, HRP Conjugated
A70340-050 50 μL

TIMELESS Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Mouse Camsap3 qPCR Primer Pair
QM37950S 200 Tests

Mouse Camsap3 qPCR Primer Pair

Sign In for Pricing
View Details