Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Competence regulatory protein ComQ (comQ)

This Recombinant Bacillus subtilis Competence regulatory protein ComQ (comQ) spans the amino acid sequence from region 1-299.

Product Specifications

Product Name Alternative

Competence regulatory protein ComQ

UniProt

P33690

Expression Region

1-299

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKEIVEQNIFNEDLSQLLYSFIDSKETFSFAESTILHYVVFGGENLDVATRLGAGIEILI LSSDIMDDLEDEDNHHALWMKINRSESLNAALSLYTVGLTSIYSLNNNPLIFKYVLKYVN EAMQGQHDDITNKSKTEDESLEVIRLKCGSLIALANVAGVLLATGEYNETVERYSYYKGI IAQISGDYYVLLSGNRSDIEKNKHTLIYLYLKRLFNDASEDLLYLISHKDLYYKSLLDKE KFQEKLIKAGVTQYISVLLEIYKQKCISAIEQLNLDKEKKELIKECLLSYTKGDTRCKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

anti-MGC27121
YF-PA23114 50 ul

anti-MGC27121

Sign In for Pricing
View Details
MUC1 Rabbit mAb
F1201-100uL*2 2x 100 μL

MUC1 Rabbit mAb

Sign In for Pricing
View Details
STOP1 Rabbit pAb
E45R28868N-100 100 µL

STOP1 Rabbit pAb

Sign In for Pricing
View Details
Human HEATR2 knockdown cell line
ABC-KD6669 1 Vial

Human HEATR2 knockdown cell line

Sign In for Pricing
View Details
RN5S277 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV744445 1.0 µg DNA

RN5S277 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Protein Phosphatase 1 beta (PP1 beta catalytic subunit, pp1b) (MaxLight 405) discontinued
P9107-15B-ML405 100 µL

Protein Phosphatase 1 beta (PP1 beta catalytic subunit, pp1b) (MaxLight 405) discontinued

Sign In for Pricing
View Details