Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Protein bem46 (bem46)

This Recombinant Schizosaccharomyces pombe Protein bem46 (bem46) spans the amino acid sequence from region 1-299.

Product Specifications

Product Name Alternative

Protein bem46

UniProt

P54069

Expression Region

1-299

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGSLSSAIFNVLKYSGMASLAVTLIALGFLYKYQKTLVYPSAFPQGSRENVPTPKEFNM EYERIELRTRDKVTLDSYLMLQSESPESRPTLLYFHANAGNMGHRLPIARVFYSALNMNV FIISYRGYGKSTGSPSEAGLKIDSQTALEYLMEHPICSKTKIVVYGQSIGGAVAIALTAK NQDRISALILENTFTSIKDMIPTVFPYGGSIISRFCTEIWSSQDEIRKIKKLPVLFLSGE KDEIVPPPQMVLLFGLCGSAKKKFHSFPKCTHNDTCLGDGYFQVIADFLAENDINTPAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (158-2B3), CF488A conjugate, 0.1mg/mL
BNC880352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF568 conjugate, 0.1mg/mL
BNC681035-500 1x 500 µL

CD8 (C8/1035), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL
BNC040266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (PAb240), CF647 conjugate, 0.1mg/mL
BNC471634-100 1x 100 µL

P53 Tumor Suppressor Protein (PAb240), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (Epidermal Growth Factor Receptor) (GFR/2968R), CF488A conjugate, 0.1mg/mL
BNC882968-100 1x 100 µL

EGFR (Epidermal Growth Factor Receptor) (GFR/2968R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (PTPRC/1131), CF488A conjugate, 0.1mg/mL
BNC881131-500 1x 500 µL

CD45RA (PTPRC/1131), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details