Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Mb3447c (Mb3447c)

This Recombinant Uncharacterized protein Mb3447c (Mb3447c) spans the amino acid sequence from region 1-299.

Product Specifications

Product Name Alternative

Uncharacterized protein Mb3447c

UniProt

P65082

Expression Region

1-299

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MREFGNPLGDRPPLDELARTDLLLDALAEREEVDFADPRDDALAALLGQWRDDLRWPPAS ALVSQDEAVAALRAGVAQRRRARRSLAAVGSVAAALLVLSGFGAVVADARPGDLLYGLHA MMFNRSRVSDDQIVLSAKANLAKVEQMIAQGQWAEAQDELAEVSSTVQAVTDGSRRQDLI NEVNLLNTKVETRDPNATLRPGSPSNPAAPGSVGNSWTPLAPVVEPPTPPTPASAAEPSM SAGVSESPMPNSTSTVAASPSTPSSKPEPGSIDPSLEPADEATNPAGQPAPETPVSPTH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRMP4 Rabbit pAb, BF700 conjugated
orb2864197 100 µL

CRMP4 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
ZADH1 Rabbit Polyclonal Antibody (BF405)
orb2523611 100 µL

ZADH1 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Myeloperoxidase (MPO) BioAssayTM ELISA Kit (Bovine) discontinued
587833 96 Tests

Myeloperoxidase (MPO) BioAssayTM ELISA Kit (Bovine) discontinued

Sign In for Pricing
View Details
Reagecon Silver Nitrate 0.1M (0.1N) Analytical Volumetric Solution (AVL)
N201005 5 L

Reagecon Silver Nitrate 0.1M (0.1N) Analytical Volumetric Solution (AVL)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Mineralocorticoid Receptor (MR)
MBS2042679-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Mineralocorticoid Receptor (MR)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Mineralocorticoid Receptor (MR)
MBS2042679-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Mineralocorticoid Receptor (MR)

Sign In for Pricing
View Details