Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Plaque-size/host range protein (PS/HR)

This Recombinant Vaccinia virus Plaque-size/host range protein (PS/HR) spans the amino acid sequence from region 18-317.

Product Specifications

Product Name Alternative

Plaque-size/host range protein, Protein B5

UniProt

O57254

Expression Region

18-317

Origin

Vaccinia virus (strain Ankara) (VACV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YSTCTVPTMNNAKLTSTETSFNNNQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCT VSDYISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEH GSCQPVKEKYSFGEYITINCDVGYEVIGASYISCTANSWNVIPSCQQKCDIPSLSNGLIS GSTFSIGGVIHLSCKSGFILTGSPSSTCIDGKWNPILPTCVRSNEKFDPVDDGPDDETDL SKLSKDVVQYEQEIESLEATYHIIIVALTIMGVIFLISVIVLVCSCDKNNDQYKFHKLLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gasdermin like (GSDMB) (NM_001042471) Human Over-expression Lysate
LY420925 100 µg

Gasdermin like (GSDMB) (NM_001042471) Human Over-expression Lysate

Sign In for Pricing
View Details
ADIG (NM_001018082) Human Over-expression Lysate
LC422646 20 µg

ADIG (NM_001018082) Human Over-expression Lysate

Sign In for Pricing
View Details
N-(Chloroacetoxy)succinimide
TRC-C363375-25G 25 g

N-(Chloroacetoxy)succinimide

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19/800), 0.2mg/mL
BNUB0800-100 1x 100 µL

Cytokeratin 19 (KRT19/800), 0.2mg/mL

Sign In for Pricing
View Details
Biotin PEG2 maleimide *CAS 305372-39-8*
3015-AAT 5 mg

Biotin PEG2 maleimide *CAS 305372-39-8*

Sign In for Pricing
View Details
Tissue FFPE Sections, Bone: femur, head
CS707040 5x 5 µm

Tissue FFPE Sections, Bone: femur, head

Sign In for Pricing
View Details