Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Surfeit locus protein 1 (SURF1)

This Recombinant Human Surfeit locus protein 1 (SURF1) spans the amino acid sequence from region 1-300.

Product Specifications

Product Name Alternative

Surfeit locus protein 1

UniProt

Q15526

Expression Region

1-300

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAVAALQLGLRAAGLGRAPASAAWRSVLRVSPRPGVAWRPSRCGSSAAEASATKAEDDS FLQWVLLLIPVTAFGLGTWQVQRRKWKLNLIAELESRVLAEPVPLPADPMELKNLEYRPV KVRGCFDHSKELYMMPRTMVDPVREAREGGLISSSTQSGAYVVTPFHCTDLGVTILVNRG FVPRKKVNPETRQKGQIEGEVDLIGMVRLTETRQPFVPENNPERNHWHYRDLEAMARITG AEPIFIDANFQSTVPGGPIGGQTRVTLRNEHLQYIVTWYGLSAATSYLWFKKFLRGTPGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Leucyl tRNA synthetase (LARS) activation kit by CRISPRa
GA109848 1 Kit

Human Leucyl tRNA synthetase (LARS) activation kit by CRISPRa

Sign In for Pricing
View Details
Fluo-2, AM
20494-AAT 10x 50 µg

Fluo-2, AM

Sign In for Pricing
View Details
Myeloperoxidase (MPO) Rabbit Monoclonal Antibody [Clone ID: R07-2C7]
TA421529 100 µL

Myeloperoxidase (MPO) Rabbit Monoclonal Antibody [Clone ID: R07-2C7]

Sign In for Pricing
View Details
Dynamin-1 Antibody
KC-1266-01 50 μL

Dynamin-1 Antibody

Sign In for Pricing
View Details
Dynamin-1 Antibody
KC-1266-02 100 µL

Dynamin-1 Antibody

Sign In for Pricing
View Details
Dynamin-1 Antibody
KC-1266-03 1 mL

Dynamin-1 Antibody

Sign In for Pricing
View Details