Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Plaque-size/host range protein (PS/HR)

This Recombinant Vaccinia virus Plaque-size/host range protein (PS/HR) spans the amino acid sequence from region 18-317.

Product Specifications

Product Name Alternative

Plaque-size/host range protein, Protein B5

UniProt

Q9JF44

Expression Region

18-317

Origin

Vaccinia virus (strain Tian Tan) (VACV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCT VSDYISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEH GSCQPVKEKYSFGEYMTINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLIS GSTFSIGGVIHLSCKSGFILTGSPSSTCIDGKWNPVLPICVRTNEEFDPVDDGPDDETDL SKLSKDVVQYEQEIESLEATYHIIMVALTIMGVIFLISVIVLVCSCDKNNDQYKFHKLLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bauhinia purpurea Gel -BPA- Immobilized Lectin
AK-2501-2 2 mL

Bauhinia purpurea Gel -BPA- Immobilized Lectin

Sign In for Pricing
View Details
LD78 beta (CCL3L1) (NM_021006) Human Recombinant Protein
TP313256 20 µg

LD78 beta (CCL3L1) (NM_021006) Human Recombinant Protein

Sign In for Pricing
View Details
Human HBEGF, Tag Free
HA211320-01 20 µg

Human HBEGF, Tag Free

Sign In for Pricing
View Details
Human HBEGF, Tag Free
HA211320-02 50 µg

Human HBEGF, Tag Free

Sign In for Pricing
View Details
Human HBEGF, Tag Free
HA211320-03 100 µg

Human HBEGF, Tag Free

Sign In for Pricing
View Details
Ent-Indoxacarb
TRC-I654005-100MG 100 mg

Ent-Indoxacarb

Sign In for Pricing
View Details