Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Plaque-size/host range protein (PS/HR)

This Recombinant Vaccinia virus Plaque-size/host range protein (PS/HR) spans the amino acid sequence from region 18-317.

Product Specifications

Product Name Alternative

Plaque-size/host range protein, Protein B5

UniProt

Q9JF44

Expression Region

18-317

Origin

Vaccinia virus (strain Tian Tan) (VACV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCT VSDYISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEH GSCQPVKEKYSFGEYMTINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLIS GSTFSIGGVIHLSCKSGFILTGSPSSTCIDGKWNPVLPICVRTNEEFDPVDDGPDDETDL SKLSKDVVQYEQEIESLEATYHIIMVALTIMGVIFLISVIVLVCSCDKNNDQYKFHKLLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EXOC1 Rabbit Polyclonal Antibody
TA376029 100 µL

EXOC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Biotin Conjugated Cancer antennarius Lectin (California Crab) -CCA-
BA-7201-1 1 mg

Biotin Conjugated Cancer antennarius Lectin (California Crab) -CCA-

Sign In for Pricing
View Details
Donitriptan Hydrochloride
TRC-D532500-10MG 10 mg

Donitriptan Hydrochloride

Sign In for Pricing
View Details
ARA9 (AIP) (NM_003977) Human Over-expression Lysate
LY401308 100 µg

ARA9 (AIP) (NM_003977) Human Over-expression Lysate

Sign In for Pricing
View Details
Human SHANK1 activation kit by CRISPRa
GA109481 1 Kit

Human SHANK1 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human Carboxypeptidase B1/CPB1 Protein (His Tag)
PKSH031567 50 µg

Recombinant Human Carboxypeptidase B1/CPB1 Protein (His Tag)

Sign In for Pricing
View Details