Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Plaque-size/host range protein (PS/HR)

This Recombinant Vaccinia virus Plaque-size/host range protein (PS/HR) spans the amino acid sequence from region 18-317.

Product Specifications

Product Name Alternative

Plaque-size/host range protein, Protein B5

UniProt

P24084

Expression Region

18-317

Origin

Vaccinia virus (strain LC16m0) (VACV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSLDPNAVCETDKWKYENPCKKMCT VSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEH GSCQPVKEKYSFGEYMTINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLIS GSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPILPTCVRSNEKFDPVDDGPDDETDL SKLSKDVVQYEQEIESLEATYHIIIVALTIMGVIFLISVIVLVCSCDKNNDQYKFHKLLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HYI Rabbit pAb
E2126090 100 µL

HYI Rabbit pAb

Sign In for Pricing
View Details
Mouse Ornithine Decarboxylase (ODC) ELISA Kit
MBS3806265-01 48 Well

Mouse Ornithine Decarboxylase (ODC) ELISA Kit

Sign In for Pricing
View Details
Mouse Ornithine Decarboxylase (ODC) ELISA Kit
MBS3806265-02 96 Well

Mouse Ornithine Decarboxylase (ODC) ELISA Kit

Sign In for Pricing
View Details
Mouse Ornithine Decarboxylase (ODC) ELISA Kit
MBS3806265-03 5x 96 Well

Mouse Ornithine Decarboxylase (ODC) ELISA Kit

Sign In for Pricing
View Details
Mouse Ornithine Decarboxylase (ODC) ELISA Kit
MBS3806265-04 10x 96 Well

Mouse Ornithine Decarboxylase (ODC) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal OPA1 Antibody (1E8-1D9) [Alexa Fluor 750]
NBP1-71656AF750 0.1 mL

Mouse Monoclonal OPA1 Antibody (1E8-1D9) [Alexa Fluor 750]

Sign In for Pricing
View Details