Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hemagglutinin 1 (hag1)

This Recombinant Hemagglutinin 1 (hag1) spans the amino acid sequence from region 1-300.

Product Specifications

Product Name Alternative

Hemagglutinin 1

UniProt

P35647

Expression Region

1-300

Origin

Eikenella corrodens

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSALSCTHERRCYAIRTHLLQNYAGMGLSHYSGSSFVAAQHTGWYLRQAARIARAAEVF ELQEDGTVLAEHILQPDSGVWTLYPQAQHKVEPLDDDFAVQLEFHCEKADYFHKKHGMTT THSAIREAVQTVAPCKTLDLGCGQGHNALFLSLAGYDVRAVDHSPAAVASVLDMAAREQL PLRADAYDINAAALNEDYDFIFATVVFIFLQAGRVPEIIADMQAHTRPGGYNLIVSAMDT ADYPCHMPFSFTFKEDELRQYYADWELLKYEEAVGLMHATDAQGRPIQLKFVTMLAKKPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL
BNC740437-500 1x 500 µL

CD47 (B6H12.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL
BNC940257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF740 conjugate, 0.1mg/mL
BNC740266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (Suprabasal Epithelial Marker) (AE20), CF647 conjugate, 0.1mg/mL
BNC471274-100 1x 100 µL

Cytokeratin 10 (Suprabasal Epithelial Marker) (AE20), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), Biotin conjugate, 0.1mg/mL
BNCB0026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC16 / CA125 (Ovarian Carcinoma Marker) (MUC16/1860), CF647 conjugate, 0.1mg/mL
BNC471860-500 1x 500 µL

MUC16 / CA125 (Ovarian Carcinoma Marker) (MUC16/1860), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details