Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas phage Pf3 Putative assembly protein ORF301

This Recombinant Pseudomonas phage Pf3 Putative assembly protein ORF301 spans the amino acid sequence from region 1-301.

Product Specifications

Product Name Alternative

Putative assembly protein ORF301, ORF301

UniProt

P03626

Expression Region

1-301

Origin

Pseudomonas phage Pf3 (Bacteriophage Pf3)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MITLITAVPGSGKTLYAIGLIEAALSEGRPVFTNISGLVKDKFSNPHLLSDAPDDWRDTP EGSLVVYDEAQQAHLYPSNAQRGPVTDERLTAMETHRHTGHDLVFITQAPTFVHHHIRKL VGLHIHLYRSRGLQAASKYEWSHVCDSPNDRKEQQRADFVLWKFPKEHFAFYTSAVMHTH KFKMPKKIGVLLVFVVLGLGAVGFNLYKNSGLASMAEATASVAEATPSPLALNGVKPSSL AAPYQWSAAAPAVPVSGCVANRSTNRCQCFDASGVVLAIEHAACLSVISSPLPRQLLSTS K

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bisphenol A-d14
TRC-B519504-10MG 10 mg

Bisphenol A-d14

Sign In for Pricing
View Details
Nrip2 (BC094230) Mouse Tagged ORF Clone
MG200595 10 µg

Nrip2 (BC094230) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CELF2 (NM_001083591) Human Recombinant Protein
TP322724M 100 µg

CELF2 (NM_001083591) Human Recombinant Protein

Sign In for Pricing
View Details
Argonaute 4 (AGO4) (NM_017629) Human Over-expression Lysate
LC402604 20 µg

Argonaute 4 (AGO4) (NM_017629) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytochrome C (CYCS) Rabbit Polyclonal Antibody
TA384075 100 µL

Cytochrome C (CYCS) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD20 (MS4A1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A4]
TA800489BM 100 µL

CD20 (MS4A1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A4]

Sign In for Pricing
View Details