Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida albicans NADH-cytochrome b5 reductase 2 (MCR1)

This Recombinant Candida albicans NADH-cytochrome b5 reductase 2 (MCR1) spans the amino acid sequence from region 1-301.

Product Specifications

Product Name Alternative

NADH-cytochrome b5 reductase 2, EC= 1.6.2.2, Mitochondrial cytochrome b reductase

UniProt

Q59M70

Expression Region

1-301

Origin

Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLTHHLSKLATPKFLVPFAGATALSIGLALQYSTSNNYIANETGKTFTDSNEWVDLKLSK SIDLTHNTKHLVFKLKDENDVSGLITASCLLTKFVTPKGNNVIRPYTPVSDVNQSGEIDF VIKKYDGGKMSSHIFDLKEGETLSFKGPIVKWKWEPNQFKSIALIGGGTGITPLYQLLHQ ITSNPKDNTKVNLIYGNLTPEDILLKKEIDAIASKHKDQVKVHYFVDKADEKKWEGQIGF ITKEFLQKELEKPGSDFKVFVCGPPGLYKAISGPKVSPTDQGELTGALKDLGFEKEHVFK F

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL
BNC681073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF594 conjugate, 0.1mg/mL
BNC941052-100 1x 100 µL

CD3e (B-B12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF647 conjugate, 0.1mg/mL
BNC470345-500 1x 500 µL

CD4 (EDU-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF488A conjugate, 0.1mg/mL
BNC881429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF405S conjugate, 0.1mg/mL
BNC040160-500 1x 500 µL

CD20 (B9E9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF488A conjugate, 0.1mg/mL
BNC880160-100 1x 100 µL

CD20 (B9E9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details