Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Syntaxin-17 (Stx17)

This Recombinant Mouse Syntaxin-17 (Stx17) spans the amino acid sequence from region 1-301.

Product Specifications

Product Name Alternative

Syntaxin-17

UniProt

Q9D0I4

Expression Region

1-301

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEDEEKVKLRRLEPAIQKFTKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGR TVQQLRSNIREMEKLCLKVHKDDLVLLKRMIDPVKEAAATATAEFLQLHLESVEELKKQV NDEELLQPSLTRSTTVDGVLHTGEAEAASQSLTQIYALPEIPQDQNAAESWETLEADLIE LSHLVTDMSLLVSSQQEKIDSIADHVNSAAVNVEEGTKNLQKAAKYKLAALPVAGALIGG VVGGPIGLLAGFKVAGIAAALGGGVLGFTGGKLIQRRKQKMMEKLTSSCPDLPSQSDKKR S

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey PINP (N-terminal propeptide of Collagen alpha-1 (I) chain) ELISA Kit
EMK0168 96 Tests

Monkey PINP (N-terminal propeptide of Collagen alpha-1 (I) chain) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal NOX3 Antibody [Janelia Fluor 549]
NBP2-41292JF549 0.1 mL

Rabbit Polyclonal NOX3 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
Phospho-NFAT5 (Ser1197) Rabbit pAb, PE-Cy5.5 conjugated
orb2885513 100 µL

Phospho-NFAT5 (Ser1197) Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
mmu-miR-505-5p miRNA Antagomir
MNM02216 2x 5.0 nmol

mmu-miR-505-5p miRNA Antagomir

Sign In for Pricing
View Details
Midkine protein (His tag)
80R-1171 100 ug

Midkine protein (His tag)

Sign In for Pricing
View Details
Recombinant Anti-CD58 Antibody (PE), Rabbit Monoclonal
MBS8106408-01 25 Tests

Recombinant Anti-CD58 Antibody (PE), Rabbit Monoclonal

Sign In for Pricing
View Details