Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Syntaxin-17 (Stx17)

This Recombinant Mouse Syntaxin-17 (Stx17) spans the amino acid sequence from region 1-301.

Product Specifications

Product Name Alternative

Syntaxin-17

UniProt

Q9D0I4

Expression Region

1-301

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEDEEKVKLRRLEPAIQKFTKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGR TVQQLRSNIREMEKLCLKVHKDDLVLLKRMIDPVKEAAATATAEFLQLHLESVEELKKQV NDEELLQPSLTRSTTVDGVLHTGEAEAASQSLTQIYALPEIPQDQNAAESWETLEADLIE LSHLVTDMSLLVSSQQEKIDSIADHVNSAAVNVEEGTKNLQKAAKYKLAALPVAGALIGG VVGGPIGLLAGFKVAGIAAALGGGVLGFTGGKLIQRRKQKMMEKLTSSCPDLPSQSDKKR S

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C6 Protein, Human, Recombinant (His Tag)
E45H50180M2-100 100 µg

C6 Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
SUSD4 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
45909154 3x 1.0 µg DNA

SUSD4 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Mouse Monoclonal CRISPR-Cpf1 Antibody (2D5-6G11) [Allophycocyanin]
NBP2-78819APC 0.1 mL

Mouse Monoclonal CRISPR-Cpf1 Antibody (2D5-6G11) [Allophycocyanin]

Sign In for Pricing
View Details
Vom1r87 3'UTR Luciferase Stable Cell Line
TU223147 1.0 mL

Vom1r87 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Quantifoil R 2/2 with Ultrathin Carbon (2 nm)
M-CEM-Q225CR2-2nm 25 Grids

Quantifoil R 2/2 with Ultrathin Carbon (2 nm)

Sign In for Pricing
View Details
HUS1 Rabbit pAb
A5407-01 20 µL

HUS1 Rabbit pAb

Sign In for Pricing
View Details