Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat RELT-like protein 2 (Rell2)

This Recombinant Rat RELT-like protein 2 (Rell2) spans the amino acid sequence from region 1-302.

Product Specifications

Product Name Alternative

RELT-like protein 2

UniProt

Q5FVJ4

Expression Region

1-302

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEPQPGLEPPQHGLYMLFLLVLVFFLMGLVGFMICHVLKKKGYRCRTSRGSEPDDAQLQ PPEDDDVNEDTVERIVRCIIQNEANAEALKEMLGDSEGEGTVQLSSVDATSSLQDGAPSH HHTVHLGSAAPCIHCSRSKRPPLVRQGRSKEGKGRPRPGETTVFSVGRFRVTHIEKRYGL HEHRDGSPTDRSWGSGGGQEPGVSQVAGGQPRTGTAAIERLLPEPPPSQAAATHPVQNGR LKDASLVPCTLEGTPGTSAELNVGTRGTGPSPGLPSQEANGQPTKLDTSGQQDSLPPEAG GM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EEF1A1P28 3'UTR GFP Stable Cell Line
TU056601 1.0 mL

EEF1A1P28 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
LINC02694 CytoSection
TS422927P5 25 Slides

LINC02694 CytoSection

Sign In for Pricing
View Details
2- (Difluoromethyl) -5-iodopyridin-4-ol
PC109875-01 5 g

2- (Difluoromethyl) -5-iodopyridin-4-ol

Sign In for Pricing
View Details
2- (Difluoromethyl) -5-iodopyridin-4-ol
PC109875-02 25 g

2- (Difluoromethyl) -5-iodopyridin-4-ol

Sign In for Pricing
View Details
BAD, Phosphorylated (S74) (BAD, BBC6, BCL2L8, Bcl2 antagonist of cell death, Bcl-2-binding component 6, Bcl-2-like protein 8, Bcl-XL/Bcl-2-associated death promoter) (MaxLight 650)
MBS6277424-01 0.1 mL

BAD, Phosphorylated (S74) (BAD, BBC6, BCL2L8, Bcl2 antagonist of cell death, Bcl-2-binding component 6, Bcl-2-like protein 8, Bcl-XL/Bcl-2-associated death promoter) (MaxLight 650)

Sign In for Pricing
View Details
BAD, Phosphorylated (S74) (BAD, BBC6, BCL2L8, Bcl2 antagonist of cell death, Bcl-2-binding component 6, Bcl-2-like protein 8, Bcl-XL/Bcl-2-associated death promoter) (MaxLight 650)
MBS6277424-02 5x 0.1 mL

BAD, Phosphorylated (S74) (BAD, BBC6, BCL2L8, Bcl2 antagonist of cell death, Bcl-2-binding component 6, Bcl-2-like protein 8, Bcl-XL/Bcl-2-associated death promoter) (MaxLight 650)

Sign In for Pricing
View Details