Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat RELT-like protein 2 (Rell2)

This Recombinant Rat RELT-like protein 2 (Rell2) spans the amino acid sequence from region 1-302.

Product Specifications

Product Name Alternative

RELT-like protein 2

UniProt

Q5FVJ4

Expression Region

1-302

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEPQPGLEPPQHGLYMLFLLVLVFFLMGLVGFMICHVLKKKGYRCRTSRGSEPDDAQLQ PPEDDDVNEDTVERIVRCIIQNEANAEALKEMLGDSEGEGTVQLSSVDATSSLQDGAPSH HHTVHLGSAAPCIHCSRSKRPPLVRQGRSKEGKGRPRPGETTVFSVGRFRVTHIEKRYGL HEHRDGSPTDRSWGSGGGQEPGVSQVAGGQPRTGTAAIERLLPEPPPSQAAATHPVQNGR LKDASLVPCTLEGTPGTSAELNVGTRGTGPSPGLPSQEANGQPTKLDTSGQQDSLPPEAG GM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Zfp568 shRNA (UAS) - Lentiviral mouse Zfp568 shRNA (UAS) plasmid
GTR15255331 1 Vial

Lentiviral mouse Zfp568 shRNA (UAS) - Lentiviral mouse Zfp568 shRNA (UAS) plasmid

Sign In for Pricing
View Details
CCND2 ELISA Kit (Human) (OKCD06547)
OKCD06547 96 Well

CCND2 ELISA Kit (Human) (OKCD06547)

Sign In for Pricing
View Details
Interleukin 13 Receptor, alpha 2 (APC)
MBS6507817-01 100 Tests

Interleukin 13 Receptor, alpha 2 (APC)

Sign In for Pricing
View Details
Interleukin 13 Receptor, alpha 2 (APC)
MBS6507817-02 5x 100 Tests

Interleukin 13 Receptor, alpha 2 (APC)

Sign In for Pricing
View Details
MYBL2 siRNA (Human)
CRH3036-01 15 nmol

MYBL2 siRNA (Human)

Sign In for Pricing
View Details
MYBL2 siRNA (Human)
CRH3036-02 30 nmol

MYBL2 siRNA (Human)

Sign In for Pricing
View Details