Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat RELT-like protein 2 (Rell2)

This Recombinant Rat RELT-like protein 2 (Rell2) spans the amino acid sequence from region 1-302.

Product Specifications

Product Name Alternative

RELT-like protein 2

UniProt

Q5FVJ4

Expression Region

1-302

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEPQPGLEPPQHGLYMLFLLVLVFFLMGLVGFMICHVLKKKGYRCRTSRGSEPDDAQLQ PPEDDDVNEDTVERIVRCIIQNEANAEALKEMLGDSEGEGTVQLSSVDATSSLQDGAPSH HHTVHLGSAAPCIHCSRSKRPPLVRQGRSKEGKGRPRPGETTVFSVGRFRVTHIEKRYGL HEHRDGSPTDRSWGSGGGQEPGVSQVAGGQPRTGTAAIERLLPEPPPSQAAATHPVQNGR LKDASLVPCTLEGTPGTSAELNVGTRGTGPSPGLPSQEANGQPTKLDTSGQQDSLPPEAG GM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ETFA (aa139-152) Immunizing Peptide
orb59942 100 µg

ETFA (aa139-152) Immunizing Peptide

Sign In for Pricing
View Details
MAP2 Antibody (C-term)
E45R12494G-1 100 µL

MAP2 Antibody (C-term)

Sign In for Pricing
View Details
SLPI Rabbit Polyclonal Antibody
orb584258 100 µL

SLPI Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lauryl hydroxysultaine
TSH-00156-01 100 mg

Lauryl hydroxysultaine

Sign In for Pricing
View Details
Lauryl hydroxysultaine
TSH-00156-02 250 mg

Lauryl hydroxysultaine

Sign In for Pricing
View Details
Lauryl hydroxysultaine
TSH-00156-03 50 mg

Lauryl hydroxysultaine

Sign In for Pricing
View Details