Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Apocytochrome f (petA)

This Recombinant Synechococcus sp. Apocytochrome f (petA) spans the amino acid sequence from region 25-327.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

Q2JUP0

Expression Region

25-327

Origin

Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YPYYAQMAYDNPREATGKIVCANCHLNAMPARAEVPQAVTPGQVFTIKVGIPYDLSKQQV LADGSKGGLNVGAVVVLPEGFRLATEEEMTEEQRQETAETYITPYSDEKPNILLVGPLPG EQHQEIVFPVVAPDPKEDPSVAFMKYRVYIGANRGRGQINPDGSLSNNNVFRAPATGRLT SIATIESDLSDLPPELAALVPPEYELPGTRVLSFETEGGLKHLVVPPGPELVVNIGDSVQ EGDPVTNNPNVGGFGQVERDLVLQNPERVKWLVAFLAAVAITQLLLVLKKKQVELIQAAE LLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF640R conjugate, 0.1mg/mL
BNC400525-500 1x 500 µL

CD63 (MX-49.129.5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF640R conjugate, 0.1mg/mL
BNC401052-100 1x 100 µL

CD3e (B-B12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL
BNC050017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL
BNC880029-100 1x 100 µL

Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF647 conjugate, 0.1mg/mL
BNC471081-500 1x 500 µL

CD45RO (190-2F2.5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF594 conjugate, 0.1mg/mL
BNC942853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details