Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse RELT-like protein 2 (Rell2)

This Recombinant Mouse RELT-like protein 2 (Rell2) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

RELT-like protein 2

UniProt

Q8BRJ3

Expression Region

1-303

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEPQPDLEPPQHGLYMLFLLVLVFFLMGLVGFMICHVLKKKGYRCRTSRGSEPDDAQLQ PPEDDDVNEDTVERIVRCIIQNEANAEALKEMLGDSEGEGTVQLSSVDATSSLQDGAPSH HHTVHLGSAAPCIHCSRSKRPPLVRQGRSKEGKSRPRPGETTVFSVGRFRVTHIEKRYGL HEHRDGSPTDRSWGSGGGQEPGGSQAAGGGQPRTGTAAIERLLPEPPPSQAAATHSVQNG RLQDASLVPCTLEGTPGTSAELNLGPRGRDPSPGLSSQEANGQPTKLDTSGQQESLPPEA GGM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human LZTFL1 Protein
NBP2-51936-0.5mg 0.5 mg

Recombinant Human LZTFL1 Protein

Sign In for Pricing
View Details
CTDSP1 (Carboxy-terminal Domain RNA Polymerase II Polypeptide A Small Phosphatase 1)
478738 100 µL

CTDSP1 (Carboxy-terminal Domain RNA Polymerase II Polypeptide A Small Phosphatase 1)

Sign In for Pricing
View Details
Rabbit anti-Drosophila melanogaster (Fruit fly) MED21 Polyclonal Antibody
MBS9015448 Inquire

Rabbit anti-Drosophila melanogaster (Fruit fly) MED21 Polyclonal Antibody

Sign In for Pricing
View Details
MAP2K5 (Mitogen-Activated Protein Kinase Kinase 5, HsT17454, MAPKK5, MEK5, PRKMK5) (AP) discontinued
248439-AP 100 µL

MAP2K5 (Mitogen-Activated Protein Kinase Kinase 5, HsT17454, MAPKK5, MEK5, PRKMK5) (AP) discontinued

Sign In for Pricing
View Details
Z-VAD-FMK
SIH-557-1MG 1 mg

Z-VAD-FMK

Sign In for Pricing
View Details
VPS34 inhibitor 1 (Compound 19)
C13430-10mM/1mL 10 mM/1mL

VPS34 inhibitor 1 (Compound 19)

Sign In for Pricing
View Details