Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse RELT-like protein 2 (Rell2)

This Recombinant Mouse RELT-like protein 2 (Rell2) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

RELT-like protein 2

UniProt

Q8BRJ3

Expression Region

1-303

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEPQPDLEPPQHGLYMLFLLVLVFFLMGLVGFMICHVLKKKGYRCRTSRGSEPDDAQLQ PPEDDDVNEDTVERIVRCIIQNEANAEALKEMLGDSEGEGTVQLSSVDATSSLQDGAPSH HHTVHLGSAAPCIHCSRSKRPPLVRQGRSKEGKSRPRPGETTVFSVGRFRVTHIEKRYGL HEHRDGSPTDRSWGSGGGQEPGGSQAAGGGQPRTGTAAIERLLPEPPPSQAAATHSVQNG RLQDASLVPCTLEGTPGTSAELNLGPRGRDPSPGLSSQEANGQPTKLDTSGQQESLPPEA GGM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR5M9 Rabbit Polyclonal Antibody
TA337548 100 µL

OR5M9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
N-Butyric Acid
1022130 500 500 mL

N-Butyric Acid

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Sorting nexin 1 (SNX1)
MBS1358346-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Sorting nexin 1 (SNX1)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Sorting nexin 1 (SNX1)
MBS1358346-02 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana Sorting nexin 1 (SNX1)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Sorting nexin 1 (SNX1)
MBS1358346-03 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana Sorting nexin 1 (SNX1)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Sorting nexin 1 (SNX1)
MBS1358346-04 0.1 mg (Yeast)

Recombinant Arabidopsis thaliana Sorting nexin 1 (SNX1)

Sign In for Pricing
View Details