Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RELT-like protein 2 (RELL2)

This Recombinant Human RELT-like protein 2 (RELL2) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

RELT-like protein 2

UniProt

Q8NC24

Expression Region

1-303

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEPQPDLEPPQHGLYMLFLLVLVFFLMGLVGFMICHVLKKKGYRCRTSRGSEPDDAQLQ PPEDDDMNEDTVERIVRCIIQNEANAEALKEMLGDSEGEGTVQLSSVDATSSLQDGAPSH HHTVHLGSAAPCLHCSRSKRPPLVRQGRSKEGKSRPRTGETTVFSVGRFRVTHIEKRYGL HEHRDGSPTDRSWGSGGGQDPGGGQGSGGGQPKAGMPAMERLPPERPQPQVLASPPVQNG GLRDSSLTPRALEGNPRASAEPTLRAGGRGPSPGLPTQEANGQPSKPDTSDHQVSLPQGA GSM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SGPP2, NT (SGPP2, Sphingosine-1-phosphate phosphatase 2, Sphingosine-1-phosphatase 2)
041674 200 µL

SGPP2, NT (SGPP2, Sphingosine-1-phosphate phosphatase 2, Sphingosine-1-phosphatase 2)

Sign In for Pricing
View Details
Human GLP-1R Alexa Fluor 750 Antibody (Clone 197920)
FAB2814S-100UG 100 µg

Human GLP-1R Alexa Fluor 750 Antibody (Clone 197920)

Sign In for Pricing
View Details
ZC3H10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2664605 3x 1.0 µg

ZC3H10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
CACNA1G Peptide
DF10014-BP 1 mg

CACNA1G Peptide

Sign In for Pricing
View Details
Human MC5R (Melanocortin 5 Receptor) ELISA Kit
EH25780 96 Tests

Human MC5R (Melanocortin 5 Receptor) ELISA Kit

Sign In for Pricing
View Details
CCL3, CT (C-C motif Chemokine 3, Small-inducible Cytokine A3, Macrophage Inflammatory Protein 1-alpha, MIP-1-alpha, Tonsillar Lymphocyte LD78 alpha Protein, G0/G1 Switch Regulatory Protein 19-1, SIS-beta, PAT 464.1, MIP-1-alpha (4-69), LD78-alpha (4-69), SCYA3, MIP1A, G0S19-1) (MaxLight 650) discontinued
M1202-09H-ML650 100 µL

CCL3, CT (C-C motif Chemokine 3, Small-inducible Cytokine A3, Macrophage Inflammatory Protein 1-alpha, MIP-1-alpha, Tonsillar Lymphocyte LD78 alpha Protein, G0/G1 Switch Regulatory Protein 19-1, SIS-beta, PAT 464.1, MIP-1-alpha (4-69), LD78-alpha (4-69), SCYA3, MIP1A, G0S19-1) (MaxLight 650) discontinued

Sign In for Pricing
View Details