Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RELT-like protein 2 (RELL2)

This Recombinant Human RELT-like protein 2 (RELL2) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

RELT-like protein 2

UniProt

Q8NC24

Expression Region

1-303

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEPQPDLEPPQHGLYMLFLLVLVFFLMGLVGFMICHVLKKKGYRCRTSRGSEPDDAQLQ PPEDDDMNEDTVERIVRCIIQNEANAEALKEMLGDSEGEGTVQLSSVDATSSLQDGAPSH HHTVHLGSAAPCLHCSRSKRPPLVRQGRSKEGKSRPRTGETTVFSVGRFRVTHIEKRYGL HEHRDGSPTDRSWGSGGGQDPGGGQGSGGGQPKAGMPAMERLPPERPQPQVLASPPVQNG GLRDSSLTPRALEGNPRASAEPTLRAGGRGPSPGLPTQEANGQPSKPDTSDHQVSLPQGA GSM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S- (+) -Rolipram
WGC308140-5mg 5 mg

S- (+) -Rolipram

Sign In for Pricing
View Details
TRPM2 Protein Vector (Rat) (pPB-N-His)
PV313163 500 ng

TRPM2 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Cavy Anti-C Reactive Protein Antibody ELISA Kit
MBS049318 Inquire

Cavy Anti-C Reactive Protein Antibody ELISA Kit

Sign In for Pricing
View Details
ASK1 Rabbit Polyclonal Antibody (PE-Cy5)
orb895592 100 µL

ASK1 Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
Rat Hepatic Oval Cells
ARP0241 0.5 Million

Rat Hepatic Oval Cells

Sign In for Pricing
View Details
Recombinant Mouse Pericentriolar Material 1 (PCM1)
RPU57875-01 50 µg

Recombinant Mouse Pericentriolar Material 1 (PCM1)

Sign In for Pricing
View Details