Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Horse Matrix metalloproteinase-9 (MMP9), partial

Product Specifications

Abbreviation

Recombinant Horse MMP9 protein, partial

Gene Name

MMP9

UniProt

F7AGL5

Expression Region

20-640aa

Organism

Equus caballus (Horse)

Target Sequence

APTRHQPTVVVFPGDLLTNLTDRELAEEYLFRYGYTGVAEMSEGDQPLERALRRLQKRLALPETGELDSTTLEAMRTPRCGVPDVGQFQTFEGDLKWHHRDITYWIQNYSGDLPRDVIDDAFARAFAVWSEVTPLTFTRVNGPQADIVIQFGVREHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDEELWSLGKGPVVPTHFGNADGAPCHFPFTFEGRSYSSCTTDGRSDDMLWCSTTADYDTDRRFGFCPSEKLYTQDGNADGKPCVFPFTFEGRSYSTCTTDGRSDGYRWCATTANYDQDKRYGFCPTRVDSTVNGGNSAGELCVFPFTFLGKEYSACTREGRSDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPAALMYPMYSFTEEPPLHEDDVNGIQYLYGPRPKPEPQPPTTTTLEPQTTVCATGPPTTRPSERPTAGPTGPPSAGPTGPPSAGPPTNPPTAGPSTAPTVPLGPGEEVCNVDIFDAIAEIGNHLHFFKDGRYWRLLEGKGRGVQGPFLIRDTWPMLPPKLDSAFEEPLTKKIFFFSGRQVWVYTGKSALGPRRLDKLGLGADVAQITGALPRGGGKVLLFSRRRFW

Tag

Tag-Free

Type

Developed Protein

Source

Yeast

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

69.0 kDa

References & Citations

"Genome sequence, comparative analysis, and population genetics of the domestic horse." Broad Institute Genome Sequencing Platform, Broad Institute Whole Genome Assembly Team Wade C.M., Giulotto E., Sigurdsson S., Zoli M., Gnerre S., Imsland F., Lear T.L., Adelson D.L., Bailey E., Bellone R.R., Bloecker H., Distl O., Edgar R.C., Garber M., Leeb T., Mauceli E., MacLeod J.N., Penedo M.C.T. Lindblad-Toh K. Science 326:865-867 (2009)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL
BNC741231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF568 conjugate, 0.1mg/mL
BNC680218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF568 conjugate, 0.1mg/mL
BNC680276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL
BNC400253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL
BNC940391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL
BNC680034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details