Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbitpox virus Cell surface-binding protein (RPXV102)

This Recombinant Rabbitpox virus Cell surface-binding protein (RPXV102) spans the amino acid sequence from region 1-304.

Product Specifications

Product Name Alternative

Cell surface-binding protein, Carbonic anhydrase homolog

UniProt

Q6RZI9

Expression Region

1-304

Origin

Rabbitpox virus (strain Utrecht) (RPV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPQQLSPINIETKKAISNARLKPLDIHYNESKPTTIQNTGKLVRINFKGGYISGGFLPNE YVLSSLHIYWGKEDDYGSNHLIDVYKYSGEINLVHWNKKKYSSYEEAKKHDDGLIIISIF LQVSDHKNVYFQKIVNQLDSIRSANTSAPFDSVFYLDNLLPSTLDYFTYLGTTINHSADA AWIIFPTPINIHSDQLSKFRTLLSSSNHDGKPHYITENYRNPYKLNDDTQVYYSGEIIRA ATTSPARDNYFMRWLSDLRETCFSYYQKYIEGNKTFAIIAIVFVFILTAILFLMSRRYSR EKQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurofilament (NF-L) (Neuronal Marker) (NEFL/2983R), CF647 conjugate, 0.1mg/mL
BNC472983-500 1x 500 µL

Neurofilament (NF-L) (Neuronal Marker) (NEFL/2983R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Benzyl 3-Amino-3-deoxy-Alpha-D-mannopyranoside Hydrochloride
TRC-B225000-500MG 500 mg

Benzyl 3-Amino-3-deoxy-Alpha-D-mannopyranoside Hydrochloride

Sign In for Pricing
View Details
3,3'-Dithiobis[6-nitrobenzoic Acid]
TRC-D479840-50G 50 g

3,3'-Dithiobis[6-nitrobenzoic Acid]

Sign In for Pricing
View Details
CCL16 Antibody
KC-1552-01 50 μL

CCL16 Antibody

Sign In for Pricing
View Details
CCL16 Antibody
KC-1552-02 100 µL

CCL16 Antibody

Sign In for Pricing
View Details
CCL16 Antibody
KC-1552-03 1 mL

CCL16 Antibody

Sign In for Pricing
View Details