Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbitpox virus Cell surface-binding protein (RPXV102)

This Recombinant Rabbitpox virus Cell surface-binding protein (RPXV102) spans the amino acid sequence from region 1-304.

Product Specifications

Product Name Alternative

Cell surface-binding protein, Carbonic anhydrase homolog

UniProt

Q6RZI9

Expression Region

1-304

Origin

Rabbitpox virus (strain Utrecht) (RPV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPQQLSPINIETKKAISNARLKPLDIHYNESKPTTIQNTGKLVRINFKGGYISGGFLPNE YVLSSLHIYWGKEDDYGSNHLIDVYKYSGEINLVHWNKKKYSSYEEAKKHDDGLIIISIF LQVSDHKNVYFQKIVNQLDSIRSANTSAPFDSVFYLDNLLPSTLDYFTYLGTTINHSADA AWIIFPTPINIHSDQLSKFRTLLSSSNHDGKPHYITENYRNPYKLNDDTQVYYSGEIIRA ATTSPARDNYFMRWLSDLRETCFSYYQKYIEGNKTFAIIAIVFVFILTAILFLMSRRYSR EKQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGFR Human Gene Knockout Kit (CRISPR)
KN414877 1 Kit

EGFR Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Flutax 1
TRC-F599400-2.5MG 2.5 mg

Flutax 1

Sign In for Pricing
View Details
Ulex Europaeus Agglutinin I (UEA I), CF®488A Conjugate
#29109 1x 1 mL

Ulex Europaeus Agglutinin I (UEA I), CF®488A Conjugate

Sign In for Pricing
View Details
Protein G Coated - 96 well Solid plates - White PS
MCW09F-PG/W 10x 96 Well Plates

Protein G Coated - 96 well Solid plates - White PS

Sign In for Pricing
View Details
KLF5 Recombinant Rabbit monoclonal Antibody
HA751557 100 µL

KLF5 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CD44v6 (Marker of Tumor Metastasis) (2F10), 0.2mg/mL
BNUB1629-500 1x 500 µL

CD44v6 (Marker of Tumor Metastasis) (2F10), 0.2mg/mL

Sign In for Pricing
View Details