Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant UPF0187 protein yneE (yneE)

This Recombinant UPF0187 protein yneE (yneE) spans the amino acid sequence from region 1-304.

Product Specifications

Product Name Alternative

UPF0187 protein yneE

UniProt

Q8XAZ3

Expression Region

1-304

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIVRPQQHWLRRIFVWHGSVLSKISSRLLLNFLFSIAVIFMLPWYTHLGIKFTLAPFSIL GVAIAIFLGFRNNAGYARYVEARKLWGQLMIASRSLLREVKTTLPDSASVREFARLQIAF AHCLRMTLRKQPQVEVLAHYLKTEDLQRVLASNSPANRILLIMGEWLAVQRRNGQLSDIL FISLNDRLNDISAVLAGCERIAYTPIPFAYTLILHRTVYLFCIMLPFALVVDLHYMTPFI SVLISYTFISLDCLAEELEDPFGTENNDLPLDAICNAIEIDLLQMNDEAEIPAKVLPDRH YQLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL
BNC400226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11), CF594 conjugate, 0.1mg/mL
BNC940470-500 1x 500 µL

CD45 / LCA (2B11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (PHE5), CF488A conjugate, 0.1mg/mL
BNC880461-100 1x 100 µL

Chromogranin A (PHE5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/2939R), CF405S conjugate, 0.1mg/mL
BNC042939-100 1x 100 µL

Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/2939R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FSH beta (FSHb/1062), CF568 conjugate, 0.1mg/mL
BNC681062-500 1x 500 µL

FSH beta (FSHb/1062), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18/835), CF647 conjugate, 0.1mg/mL
BNC470835-500 1x 500 µL

Cytokeratin 18 (KRT18/835), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details