Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Cell surface-binding protein (TD8L)

This Recombinant Vaccinia virus Cell surface-binding protein (TD8L) spans the amino acid sequence from region 1-304.

Product Specifications

Product Name Alternative

Cell surface-binding protein, Carbonic anhydrase homolog

UniProt

Q9JFA1

Expression Region

1-304

Origin

Vaccinia virus (strain Tian Tan) (VACV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPQQLSPINIETKKAISNARLKPLDIHYNESKPTTIQNTGKLVRINFKGGYISGGFLPNE YVLSSLHIYWGKEDDYGSNHLIDVYKYSGEINLVHWNKKKYSSYEEAKKHDDGLIIISIF LQVSDHKNVYFQKIVNQLDSIRSANTSAPFDSVFYLDNLLPSKLDYFTYLGTTINHSADA VWIIFPTPINIHSDQLSKFRTLLSSSNHEGKPHYITENYRNPYKLNDDTQVYYSGEIIRA ATTPPARENYFMRWLSDLRETCFSYYQKYIEENKTFAIIAIVFVFILTAILFFMSRRYSR EKQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Caragana arborescens Lectin (Pea Tree) -CAA-,  15nm
GP-6701-15 1 mL

Colloidal Gold Conjugated Caragana arborescens Lectin (Pea Tree) -CAA-, 15nm

Sign In for Pricing
View Details
KAP1 Antibody
KC-23578-01 50 μL

KAP1 Antibody

Sign In for Pricing
View Details
KAP1 Antibody
KC-23578-02 100 µL

KAP1 Antibody

Sign In for Pricing
View Details
KAP1 Antibody
KC-23578-03 1 mL

KAP1 Antibody

Sign In for Pricing
View Details
Peripherin Antibody
8C0301-AAT 50 µg

Peripherin Antibody

Sign In for Pricing
View Details
MRPL45 (NM_001278279) Human Tagged ORF Clone
RG236984 10 µg

MRPL45 (NM_001278279) Human Tagged ORF Clone

Sign In for Pricing
View Details