Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Thermosynechococcus vulcanus Cytochrome c oxidase subunit 2 (ctaC)

This Recombinant Thermosynechococcus vulcanus Cytochrome c oxidase subunit 2 (ctaC) spans the amino acid sequence from region 24-327.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 2, EC= 1.9.3.1, Cytochrome aa3 subunit 2, Cytochrome c oxidase polypeptide II, Oxidase aa (3) subunit 2

UniProt

P98054

Expression Region

24-327

Origin

Thermosynechococcus vulcanus (Synechococcus vulcanus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

VGHHHGLLPEQASEQAPLVDNFFDIMLTIGTALFLVVQGAIILFVIRYRRRAGEEGDGLP VEGNLPLEAFWTAIPALIVIFLGIYSVDIFQRMGGLNPGDHAMHSMHAPKSGMAVVAQAP SKTTSDATALLAAAQPPEIGIGASPDVQGKAPDLVVDVAGMQYAWIFTYPDSGIVSGELH IPVGKDVQLNLSARDVIHSFWVPQFRLKQDAIPGVPTTRFKATKVGTYPVVCAELCGGYH GAMRTQVIVHTPEDFETWRRQNQAIATAPVIPSLRDRHIHEMGVTAELVAQVEAIAHDPS AEKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL
BNC400204-500 1x 500 µL

Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF594 conjugate, 0.1mg/mL
BNC940305-500 1x 500 µL

CD95 (B-R18), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL
BNC741820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF640R conjugate, 0.1mg/mL
BNC400994-500 1x 500 µL

TNF alpha (J2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF594 conjugate, 0.1mg/mL
BNC940218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL
BNC040225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details