Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Variola virus Cell surface-binding protein (D8L)

This Recombinant Variola virus Cell surface-binding protein (D8L) spans the amino acid sequence from region 1-304.

Product Specifications

Product Name Alternative

Cell surface-binding protein, Carbonic anhydrase homolog

UniProt

P33065

Expression Region

1-304

Origin

Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSQQLSPINIETKKAISNARLKPLNIHYNESKPTTIQNTGKLVRINFKGGYLSGGFLPNE YVLSSLHIYWGKEDDYGSNHLIDVYKYSGEINLVHWNKKKYSSYEEAKKHDDGLIIISIF LQVSDHKNVYFQKIVNQLDSIRTANTSAPFDSVFYLDNLLPSKLDYFKYLGTTINHSADA VWIIFPTPINIHSDQLSKFRTLLSLSNHEGKPHYITENYRNPYKLNDDTEVYYSGEIIRA ATTSPARENYFMRWLSDLRETCFSYYQKYIEGNKTFAIIAIVFVYILTAILFLMSRRYSR EKQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CA5B (NM_007220) Human Recombinant Protein
TP720091 10 µg

CA5B (NM_007220) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS708400 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
cis-tert-butyl 3-phenylaziridine-2-carboxylate
TRC-B490943-500MG 500 mg

cis-tert-butyl 3-phenylaziridine-2-carboxylate

Sign In for Pricing
View Details
Filaggrin (Keratinocyte Differentiation Marker) (FLG/1957R), CF640R conjugate, 0.1mg/mL
BNC401957-500 1x 500 µL

Filaggrin (Keratinocyte Differentiation Marker) (FLG/1957R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DNAJB12 Rabbit Polyclonal Antibody
TA375522 100 µL

DNAJB12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KCNH1 (NM_002238) Human Over-expression Lysate
LY419457 100 µg

KCNH1 (NM_002238) Human Over-expression Lysate

Sign In for Pricing
View Details