Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 74 (Tmem74)

This Recombinant Mouse Transmembrane protein 74 (Tmem74) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Transmembrane protein 74

UniProt

Q8BQU7

Expression Region

1-305

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELHSLSKRNSPVDPCNALEWSSGETSGDHIEEATIRDAFCYQKNLVSTPRADVVEVCRL STSPASPTSLLQDSAIQTSFSLSGPPDSGNNQVMADRKVCNCCSQELETSFTYVDENVNL EQRSQRSPSAKGSNHPVDLGWGNPNEWSHETAMSLMSEDDDDTSSEATSSGKSVDYGFIS AILFLVTGILLVIISYIVPREVTVDPNTVAAREMERLEKESAMLGAHLDRCVIAGLCLLT LGGVVLSCLLMMSMWKGELYRRNRFASSKESAKLYGSFNFRMKTSTNEDTLELSLVEEDA LAVQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPA1B siRNA (Rat)
MBS8210282-01 15 nmol

HSPA1B siRNA (Rat)

Sign In for Pricing
View Details
HSPA1B siRNA (Rat)
MBS8210282-02 30 nmol

HSPA1B siRNA (Rat)

Sign In for Pricing
View Details
HSPA1B siRNA (Rat)
MBS8210282-03 5x 30 nmol

HSPA1B siRNA (Rat)

Sign In for Pricing
View Details
Rabbit Polyclonal sFRP-4 Antibody [DyLight 650]
NBP2-98217C 0.1 mL

Rabbit Polyclonal sFRP-4 Antibody [DyLight 650]

Sign In for Pricing
View Details
Rabbit Anti Human CD55 Polyclonal Antigen affinity Purified (PBS with 0.05% NaN3 and 40% Glycerol, pH7.4) (Western Blot,IHC,ELISA) 200ul
IRBAHUCD55AAP480200UL 200 µL

Rabbit Anti Human CD55 Polyclonal Antigen affinity Purified (PBS with 0.05% NaN3 and 40% Glycerol, pH7.4) (Western Blot,IHC,ELISA) 200ul

Sign In for Pricing
View Details
EF-1β (PTR2161) Antibody
W0449-01 20 µL

EF-1β (PTR2161) Antibody

Sign In for Pricing
View Details