Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 74 (Tmem74)

This Recombinant Mouse Transmembrane protein 74 (Tmem74) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Transmembrane protein 74

UniProt

Q8BQU7

Expression Region

1-305

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELHSLSKRNSPVDPCNALEWSSGETSGDHIEEATIRDAFCYQKNLVSTPRADVVEVCRL STSPASPTSLLQDSAIQTSFSLSGPPDSGNNQVMADRKVCNCCSQELETSFTYVDENVNL EQRSQRSPSAKGSNHPVDLGWGNPNEWSHETAMSLMSEDDDDTSSEATSSGKSVDYGFIS AILFLVTGILLVIISYIVPREVTVDPNTVAAREMERLEKESAMLGAHLDRCVIAGLCLLT LGGVVLSCLLMMSMWKGELYRRNRFASSKESAKLYGSFNFRMKTSTNEDTLELSLVEEDA LAVQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1417 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
32856114 3x 1.0 µg

Olfr1417 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Gemin4 (A-1) P
sc-166078 P 100 µg - 0.5 mL

Gemin4 (A-1) P

Sign In for Pricing
View Details
Lentiviral mouse Ctsl shRNA (UAS) - Lentiviral mouse Ctsl shRNA (UAS, GFP) plasmid
GTR15151342 1 Vial

Lentiviral mouse Ctsl shRNA (UAS) - Lentiviral mouse Ctsl shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
D-Xylo-Pentodialdo-5,2-Furanose, 4,5-O- (1-Methylethylidene) -1-C-4-Morpholinyl-, (5S) -
D4910 100 mg

D-Xylo-Pentodialdo-5,2-Furanose, 4,5-O- (1-Methylethylidene) -1-C-4-Morpholinyl-, (5S) -

Sign In for Pricing
View Details
MOCS3 Human siRNA Oligo Duplex (Locus ID 27304)
SR309080 1 Kit

MOCS3 Human siRNA Oligo Duplex (Locus ID 27304)

Sign In for Pricing
View Details
FLI1 Antibody
MBS7104405-01 0.05 mg

FLI1 Antibody

Sign In for Pricing
View Details