Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 74 (Tmem74)

This Recombinant Mouse Transmembrane protein 74 (Tmem74) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Transmembrane protein 74

UniProt

Q8BQU7

Expression Region

1-305

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELHSLSKRNSPVDPCNALEWSSGETSGDHIEEATIRDAFCYQKNLVSTPRADVVEVCRL STSPASPTSLLQDSAIQTSFSLSGPPDSGNNQVMADRKVCNCCSQELETSFTYVDENVNL EQRSQRSPSAKGSNHPVDLGWGNPNEWSHETAMSLMSEDDDDTSSEATSSGKSVDYGFIS AILFLVTGILLVIISYIVPREVTVDPNTVAAREMERLEKESAMLGAHLDRCVIAGLCLLT LGGVVLSCLLMMSMWKGELYRRNRFASSKESAKLYGSFNFRMKTSTNEDTLELSLVEEDA LAVQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FLT1 Recombinant Monoclonal Antibody
A78521-50UL 50 μL

FLT1 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
SPIRE2 siRNA Oligos set (Human)
45349171 3x 5 nmol

SPIRE2 siRNA Oligos set (Human)

Sign In for Pricing
View Details
SLC12A1 Antibody - N-terminal region
OABB01875-100UG 100 µg/Vial

SLC12A1 Antibody - N-terminal region

Sign In for Pricing
View Details
Decyl-CoA, disulfide5
HY-CE01566 1 Each

Decyl-CoA, disulfide5

Sign In for Pricing
View Details
Rat rno-miR-3590-5p miRNA Agomir
abx885150-01 5 nmol

Rat rno-miR-3590-5p miRNA Agomir

Sign In for Pricing
View Details
Rat rno-miR-3590-5p miRNA Agomir
abx885150-02 10 nmol

Rat rno-miR-3590-5p miRNA Agomir

Sign In for Pricing
View Details