Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 74 (TMEM74)

This Recombinant Human Transmembrane protein 74 (TMEM74) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Transmembrane protein 74

UniProt

Q96NL1

Expression Region

1-305

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELHYLAKKSNQADLCDARDWSSRGLPGDQADTAATRAALCCQKQCASTPRATEMEGSKL SSSPASPSSSLQNSTLQPDAFPPGLLHSGNNQITAERKVCNCCSQELETSFTYVDKNINL EQRNRSSPSAKGHNHPGELGWENPNEWSQEAAISLISEEEDDTSSEATSSGKSIDYGFIS AILFLVTGILLVIISYIVPREVTVDPNTVAAREMERLEKESARLGAHLDRCVIAGLCLLT LGGVILSCLLMMSMWKGELYRRNRFASSKESAKLYGSFNFRMKTSTNENTLELSLVEEDA LAVQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (186-2G9), CF640R conjugate, 0.1mg/mL
BNC400178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF405S conjugate, 0.1mg/mL
BNC040012-500 1x 500 µL

Tyrosinase (T311), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GFAP (Astrocyte & Neural Stem Cell Marker) (GFAP/2076), CF647 conjugate, 0.1mg/mL
BNC472076-500 1x 500 µL

GFAP (Astrocyte & Neural Stem Cell Marker) (GFAP/2076), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/144B), CF488A conjugate, 0.1mg/mL
BNC880749-100 1x 100 µL

CD8 (C8/144B), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/2340R), CF488A conjugate, 0.1mg/mL
BNC882340-500 1x 500 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/2340R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL
BNC040225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details