Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable protease sohB (sohB)

This Recombinant Probable protease sohB (sohB) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Probable protease sohB, EC= 3.4.21.-

UniProt

Q44600

Expression Region

1-305

Origin

Buchnera aphidicola subsp. Schlechtendalia chinensis

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDFILNYALFFFKIFTLFALILTIFLIIVNVARHKSKKKYELDIVSLNSYYEHVKNKIIL STMSTYEKKIWNKSNKLFKKTRSKINMTFLKKNKYYLNQNNPILYVLDFKGNVSASEVTS LREEISAIILAAKENDEVLLRLESGGGVIHGYGLASSQLSRLREKNIRLTVSVDKIAASG GYMMACVANYIIAAPFSVIGSIGVVAQIPNFNKLLKKNNVDMELHTSGLYKRTLTVFGEN TKEAREKFCKDLNFTHVLFKEFVHSMRPSLNIDEVSTGEHWFGTTALEKKLIDKIETSDD FIISR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Boc-D-aspartic acid a-benzyl ester 98+% (HPLC)
236155-01 1 g

Boc-D-aspartic acid a-benzyl ester 98+% (HPLC)

Sign In for Pricing
View Details
Boc-D-aspartic acid a-benzyl ester 98+% (HPLC)
236155-02 5 g

Boc-D-aspartic acid a-benzyl ester 98+% (HPLC)

Sign In for Pricing
View Details
Boc-D-aspartic acid a-benzyl ester 98+% (HPLC)
236155-03 25 g

Boc-D-aspartic acid a-benzyl ester 98+% (HPLC)

Sign In for Pricing
View Details
Recombinant Clostridium Tetani bioD Protein (aa 1-227)
VAng-Lsx01534-500gEcoli 500 µg (E. coli)

Recombinant Clostridium Tetani bioD Protein (aa 1-227)

Sign In for Pricing
View Details
Human Tryptase (TPS) ELISA Kit
SL2496Hu-01 48 Tests

Human Tryptase (TPS) ELISA Kit

Sign In for Pricing
View Details
Human Tryptase (TPS) ELISA Kit
SL2496Hu-02 96 Tests

Human Tryptase (TPS) ELISA Kit

Sign In for Pricing
View Details