Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ashbya gossypii J domain-containing protein 1 (JID1)

This Recombinant Ashbya gossypii J domain-containing protein 1 (JID1) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

J domain-containing protein 1

UniProt

Q75BG6

Expression Region

1-305

Origin

Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAKRANWSLDGQQSSGGGAASWICACTDKISIAKALTRSLSVMLSRPTALLRTGARWRVS LTASGRSTVRCASTVAGWQGGLSWPQGKQPTPYEVLGLVKTGVDARQLKKRYHELAKLYH PDTAGAAQQGLGEHERLRRFKLVNEAYALLSDASRRRMYDMYATGWAHGPAPMAPAMAHG AYHERYAYYNAGTWEDMQDLNSDRQQVQFSAWGMVVWALCMLAGFQVMAFLIRLEERTSK SAHTHEEAEHALLLAHLNYGLDQDRVSRVRRFLWFRSWGLYRTKAELDEAARTNEALVRQ LEGGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD74 (BU45), CF740 conjugate, 0.1mg/mL
BNC740189-100 1x 100 µL

CD74 (BU45), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL
BNC880029-100 1x 100 µL

Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF568 conjugate, 0.1mg/mL
BNC680333-500 1x 500 µL

CD8 (RIV11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF647 conjugate, 0.1mg/mL
BNC471045-100 1x 100 µL

CD16 (C16/1045), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/1523), CF568 conjugate, 0.1mg/mL
BNC682309-100 1x 100 µL

NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/1523), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL
BNC551050-500 1x 500 µL

CD3e (CRIS-7), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details