Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Popeye domain-containing protein 3 (POPDC3)

This Recombinant Chicken Popeye domain-containing protein 3 (POPDC3) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Popeye domain-containing protein 3, Popeye protein 3

UniProt

Q9DG25

Expression Region

1-305

Origin

Gallus gallus (Chicken)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGENASFWESLIYAHPTCVTWKQEAEGSIYHLASILFVVGFMGGSGFSGLLYVFSLLGLG FLCSSVWAWLDVCAADIFSWNFILFAICFVQFIYVTYQVRSVSFDKEFQELYSALFQPLG ISLTVYRKIVLCCDAEVITLEKEHCYAMQGKTPIDKLSLLVSGRIRVTVDGEFLHYIFPL QFLDSPEWDSLRPTEEGIFQVTLTAETDCRYVAWRRKKLYLLFAKHRFISRLFSILIGSD IAEKLYALNDRVHVGKGFRYDIRLPNFYHTSLPETPPVPPPRRLQRRSSGRPRPGVPNCS SPRKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apg3 (ATG3) (NM_022488) Human 3' UTR Clone
SC204173 10 µg

Apg3 (ATG3) (NM_022488) Human 3' UTR Clone

Sign In for Pricing
View Details
Mouse CENPK shRNA Plasmid
abx975206-01 150 µg

Mouse CENPK shRNA Plasmid

Sign In for Pricing
View Details
Mouse CENPK shRNA Plasmid
abx975206-02 300 µg

Mouse CENPK shRNA Plasmid

Sign In for Pricing
View Details
SNX10 (Sorting Nexin-10) (HRP)
MBS6155114-01 0.1 mL

SNX10 (Sorting Nexin-10) (HRP)

Sign In for Pricing
View Details
SNX10 (Sorting Nexin-10) (HRP)
MBS6155114-02 5x 0.1 mL

SNX10 (Sorting Nexin-10) (HRP)

Sign In for Pricing
View Details
Symplekin (SYMPK) Antibody
abx131604-01 100 µL

Symplekin (SYMPK) Antibody

Sign In for Pricing
View Details