Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Popeye domain-containing protein 3 (POPDC3)

This Recombinant Chicken Popeye domain-containing protein 3 (POPDC3) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Popeye domain-containing protein 3, Popeye protein 3

UniProt

Q9DG25

Expression Region

1-305

Origin

Gallus gallus (Chicken)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGENASFWESLIYAHPTCVTWKQEAEGSIYHLASILFVVGFMGGSGFSGLLYVFSLLGLG FLCSSVWAWLDVCAADIFSWNFILFAICFVQFIYVTYQVRSVSFDKEFQELYSALFQPLG ISLTVYRKIVLCCDAEVITLEKEHCYAMQGKTPIDKLSLLVSGRIRVTVDGEFLHYIFPL QFLDSPEWDSLRPTEEGIFQVTLTAETDCRYVAWRRKKLYLLFAKHRFISRLFSILIGSD IAEKLYALNDRVHVGKGFRYDIRLPNFYHTSLPETPPVPPPRRLQRRSSGRPRPGVPNCS SPRKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ICAM-1/CD54 Antibody
NBP1-88701-25ul 25 µL

Rabbit Polyclonal ICAM-1/CD54 Antibody

Sign In for Pricing
View Details
SYP Antibody (C-term)
AM1945b 400 µL

SYP Antibody (C-term)

Sign In for Pricing
View Details
LRRC15 Rabbit Polyclonal Antibody
orb101141-01 50 μL

LRRC15 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LRRC15 Rabbit Polyclonal Antibody
orb101141-02 100 µL

LRRC15 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LRRC15 Rabbit Polyclonal Antibody
orb101141-03 200 µL

LRRC15 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-SAPK/JNK (Thr183/Tyr185) (81E11) Rabbit Monoclonal Antibody (BSA and Azide Free)
CST 58328SF 100 µg

Phospho-SAPK/JNK (Thr183/Tyr185) (81E11) Rabbit Monoclonal Antibody (BSA and Azide Free)

Sign In for Pricing
View Details