Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Peroxisome biogenesis factor 2 (Pex2)

This Recombinant Rat Peroxisome biogenesis factor 2 (Pex2) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Peroxisome biogenesis factor 2, Peroxin-2, Peroxisomal membrane protein 3, Peroxisome assembly factor 1, PAF-1

UniProt

P24392

Expression Region

1-305

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAREESTQSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVKAFL WLFLWRFTIYSKNATVGQSVLNIQYKNDSSPNPVYQPPSKNQKLLYAVCTIGGRWLEERC YDLFRNRHLASFGKAKQCMNFVVGLLKLGELMNFLIFLQKGKFATLTERLLGIHSVFCKP QSMREVGFEYMNRELLWHGFAEFLVFLLPLINIQKLKAKLSSWCIPLTSTAGSDSTLGSS GKECALCGEWPTMPHTIGCEHVFCYYCVKSSFLFDMYFTCPKCGTEVHSVQPLKSGIEMS EVNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTUS2 Rabbit Polyclonal Antibody (BF405)
orb2485053 100 µL

MTUS2 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Anti-non-muscle Myosin IIB/MYH10 Antibody Picoband®, HRP Conjugate
A02681-1-HRP 100 µg/Vial

Anti-non-muscle Myosin IIB/MYH10 Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details
p53 Recombinant Rabbit Monoclonal Antibody [JB42-26]
ET7107-33 100 µL

p53 Recombinant Rabbit Monoclonal Antibody [JB42-26]

Sign In for Pricing
View Details
ATXN2 Antibody
orb1249069 0.1 mg

ATXN2 Antibody

Sign In for Pricing
View Details
NFKBIA Protein Vector (Human) (pPB-N-His)
PV028194 500 ng

NFKBIA Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
BTN3A3 Protein (C-His, Human)
P513559 100 µg

BTN3A3 Protein (C-His, Human)

Sign In for Pricing
View Details