Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Peroxisome biogenesis factor 2 (Pex2)

This Recombinant Rat Peroxisome biogenesis factor 2 (Pex2) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Peroxisome biogenesis factor 2, Peroxin-2, Peroxisomal membrane protein 3, Peroxisome assembly factor 1, PAF-1

UniProt

P24392

Expression Region

1-305

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAREESTQSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVKAFL WLFLWRFTIYSKNATVGQSVLNIQYKNDSSPNPVYQPPSKNQKLLYAVCTIGGRWLEERC YDLFRNRHLASFGKAKQCMNFVVGLLKLGELMNFLIFLQKGKFATLTERLLGIHSVFCKP QSMREVGFEYMNRELLWHGFAEFLVFLLPLINIQKLKAKLSSWCIPLTSTAGSDSTLGSS GKECALCGEWPTMPHTIGCEHVFCYYCVKSSFLFDMYFTCPKCGTEVHSVQPLKSGIEMS EVNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 glycoprotein Polyclonal Antibody
MBS9415154-01 0.1 mg

CD59 glycoprotein Polyclonal Antibody

Sign In for Pricing
View Details
CD59 glycoprotein Polyclonal Antibody
MBS9415154-02 5x 0.1 mg

CD59 glycoprotein Polyclonal Antibody

Sign In for Pricing
View Details
Keratin 17/19 Antibody [L1M17]
C21595-50uL 50 μL

Keratin 17/19 Antibody [L1M17]

Sign In for Pricing
View Details
PLB1 Rabbit Polyclonal Antibody (BF555)
orb2416889 100 µL

PLB1 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
ApoL-VI shRNA Plasmid (h)
sc-72522-SH 20 µg

ApoL-VI shRNA Plasmid (h)

Sign In for Pricing
View Details
Mouse Monoclonal LZIC Antibody (OTI5E3) [Alexa Fluor 350]
NBP2-72561AF350 0.1 mL

Mouse Monoclonal LZIC Antibody (OTI5E3) [Alexa Fluor 350]

Sign In for Pricing
View Details