Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Peroxisome biogenesis factor 2 (Pex2)

This Recombinant Rat Peroxisome biogenesis factor 2 (Pex2) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Peroxisome biogenesis factor 2, Peroxin-2, Peroxisomal membrane protein 3, Peroxisome assembly factor 1, PAF-1

UniProt

P24392

Expression Region

1-305

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAREESTQSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVKAFL WLFLWRFTIYSKNATVGQSVLNIQYKNDSSPNPVYQPPSKNQKLLYAVCTIGGRWLEERC YDLFRNRHLASFGKAKQCMNFVVGLLKLGELMNFLIFLQKGKFATLTERLLGIHSVFCKP QSMREVGFEYMNRELLWHGFAEFLVFLLPLINIQKLKAKLSSWCIPLTSTAGSDSTLGSS GKECALCGEWPTMPHTIGCEHVFCYYCVKSSFLFDMYFTCPKCGTEVHSVQPLKSGIEMS EVNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAF1L (Transcription Initiation Factor TFIID Subunit 1-like, Transcription Initiation Factor TFIID 210kD Subunit, TAF (II) 210, TBP-associated Factor 210kD, TBP-associated Factor 1-like, MGC134910)
134188 100 µg

TAF1L (Transcription Initiation Factor TFIID Subunit 1-like, Transcription Initiation Factor TFIID 210kD Subunit, TAF (II) 210, TBP-associated Factor 210kD, TBP-associated Factor 1-like, MGC134910)

Sign In for Pricing
View Details
HRAS Protein Lysate (Rat) with C-HA Tag
23887036 100 µg

HRAS Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
ZNF608 (NM_020747) Human Tagged ORF Clone Lentiviral Particle
RC217099L4V 200 µL

ZNF608 (NM_020747) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human High-density lipoprotein 3 cholesterol,HDL3-C ELISA KIT
E7361Hu-01 48 Well

Human High-density lipoprotein 3 cholesterol,HDL3-C ELISA KIT

Sign In for Pricing
View Details
Human High-density lipoprotein 3 cholesterol,HDL3-C ELISA KIT
E7361Hu-02 96 Well

Human High-density lipoprotein 3 cholesterol,HDL3-C ELISA KIT

Sign In for Pricing
View Details
Human High-density lipoprotein 3 cholesterol,HDL3-C ELISA KIT
E7361Hu-03 5x 96 Tests

Human High-density lipoprotein 3 cholesterol,HDL3-C ELISA KIT

Sign In for Pricing
View Details