Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Peroxisome biogenesis factor 2 (Pex2)

This Recombinant Mouse Peroxisome biogenesis factor 2 (Pex2) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Peroxisome biogenesis factor 2, Peroxin-2, Peroxisomal membrane protein 3, Peroxisome assembly factor 1, PAF-1

UniProt

P55098

Expression Region

1-305

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAREESTQSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVKAFL WLFLWRFTIYSKNATVGQSVLNIQHKNDSSPNPVYQPPSKNQKLLYAVCTIGGRWLEERC YDLFRNRHLASFGKAKQCMNFVVGLLKLGELMNFLIFLQKGKFATLTERLLGIHSVFCKP QNMREVGFEYMNRELLWHGFAEFLIFLLPLINIQKLKAKLSSWCTLCTGAAGHDSTLGSS GKECALCGEWPTMPHTIGCEHVFCYYCVKSSFLFDIYFTCPKCGTEVHSVQPLKAGIQMS EVNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CACNB4 Protein Vector (Mouse) (pPB-C-His)
PV160934 500 ng

CACNB4 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
CAL-101 (Idelalisib, GS-1101)
A3005-100 100 mg

CAL-101 (Idelalisib, GS-1101)

Sign In for Pricing
View Details
Anti-Rad17 Antibody
MBS1753496-01 0.01 mg

Anti-Rad17 Antibody

Sign In for Pricing
View Details
Anti-Rad17 Antibody
MBS1753496-02 0.1 mg (Carrier Free)

Anti-Rad17 Antibody

Sign In for Pricing
View Details
Anti-Rad17 Antibody
MBS1753496-03 0.1 mg

Anti-Rad17 Antibody

Sign In for Pricing
View Details
Anti-Rad17 Antibody
MBS1753496-04 0.1 mg (Cy3)

Anti-Rad17 Antibody

Sign In for Pricing
View Details