Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Peroxisome biogenesis factor 2 (Pex2)

This Recombinant Mouse Peroxisome biogenesis factor 2 (Pex2) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Peroxisome biogenesis factor 2, Peroxin-2, Peroxisomal membrane protein 3, Peroxisome assembly factor 1, PAF-1

UniProt

P55098

Expression Region

1-305

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAREESTQSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVKAFL WLFLWRFTIYSKNATVGQSVLNIQHKNDSSPNPVYQPPSKNQKLLYAVCTIGGRWLEERC YDLFRNRHLASFGKAKQCMNFVVGLLKLGELMNFLIFLQKGKFATLTERLLGIHSVFCKP QNMREVGFEYMNRELLWHGFAEFLIFLLPLINIQKLKAKLSSWCTLCTGAAGHDSTLGSS GKECALCGEWPTMPHTIGCEHVFCYYCVKSSFLFDIYFTCPKCGTEVHSVQPLKAGIQMS EVNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cubilin siRNA (r)
sc-108042 10 µM

Cubilin siRNA (r)

Sign In for Pricing
View Details
SNAI1 (SNAH, Zinc Finger Protein SNAI1, Protein Snail Homolog 1, Protein Sna) (AP)
MBS6394542-01 0.1 mL

SNAI1 (SNAH, Zinc Finger Protein SNAI1, Protein Snail Homolog 1, Protein Sna) (AP)

Sign In for Pricing
View Details
SNAI1 (SNAH, Zinc Finger Protein SNAI1, Protein Snail Homolog 1, Protein Sna) (AP)
MBS6394542-02 5x 0.1 mL

SNAI1 (SNAH, Zinc Finger Protein SNAI1, Protein Snail Homolog 1, Protein Sna) (AP)

Sign In for Pricing
View Details
PLVAP Recombinant Protein (Mouse)
RP163001 100 µg

PLVAP Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Teichoic acid translocation permease protein tagG (tagG)
orb2911155-01 20 µg

Recombinant Bacillus subtilis Teichoic acid translocation permease protein tagG (tagG)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Teichoic acid translocation permease protein tagG (tagG)
orb2911155-02 100 µg

Recombinant Bacillus subtilis Teichoic acid translocation permease protein tagG (tagG)

Sign In for Pricing
View Details