Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Peroxisome biogenesis factor 2 (Pex2)

This Recombinant Mouse Peroxisome biogenesis factor 2 (Pex2) spans the amino acid sequence from region 1-305.

Product Specifications

Product Name Alternative

Peroxisome biogenesis factor 2, Peroxin-2, Peroxisomal membrane protein 3, Peroxisome assembly factor 1, PAF-1

UniProt

P55098

Expression Region

1-305

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAREESTQSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVKAFL WLFLWRFTIYSKNATVGQSVLNIQHKNDSSPNPVYQPPSKNQKLLYAVCTIGGRWLEERC YDLFRNRHLASFGKAKQCMNFVVGLLKLGELMNFLIFLQKGKFATLTERLLGIHSVFCKP QNMREVGFEYMNRELLWHGFAEFLIFLLPLINIQKLKAKLSSWCTLCTGAAGHDSTLGSS GKECALCGEWPTMPHTIGCEHVFCYYCVKSSFLFDIYFTCPKCGTEVHSVQPLKAGIQMS EVNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC2A3P1 AAV siRNA Pooled Vector
44098161 1.0 µg

SLC2A3P1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Lcn2 sgRNA CRISPR Lentivector set (Rat)
K7117601 3x 1.0 µg

Lcn2 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
F122A, ID (FAM122A, C9orf42, Protein FAM122A) (Biotin) discontinued
035302-Biotin 200 µL

F122A, ID (FAM122A, C9orf42, Protein FAM122A) (Biotin) discontinued

Sign In for Pricing
View Details
Trim71 Mouse shRNA Lentiviral Particle (Locus ID 636931)
TL514800V 500 µL Each

Trim71 Mouse shRNA Lentiviral Particle (Locus ID 636931)

Sign In for Pricing
View Details
RGD1561444 3'UTR GFP Stable Cell Line
TU268394 1.0 mL

RGD1561444 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human TNFAIP8L2 Protein Lysate
MBS8428892-01 0.02 mg

Human TNFAIP8L2 Protein Lysate

Sign In for Pricing
View Details