Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein Ddg (lpxP)

This Recombinant Protein Ddg (lpxP) spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

Protein Ddg

UniProt

P0ACV3

Expression Region

1-306

Origin

Shigella flexneri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFPQCKFSREFLHPRYWLTWFGLGVLWLWVQLPYPVLCFLGTRIGAMARPFLKRRESIAR KNLELCFPQHSAEEREKMIAENFRSLGMALVETGMAWFWPDSRVRKWFDVEGLDNLKRAQ MQNRGVMVVGVHFMSLELGGRVMGLCQPMMATYRPHNNQLMEWVQTRGRMRSNKAMIGRN NLRGIVGALKKGEAVWFAPDQDYGRKGSSFAPFFAVENVATTNGTYVLSRLSGAAMLTVT MVRKADYSGYRLFITPEMEGYPTDENQAAAYMNKIIEKEIMRAPEQYLWIHRRFKTRPVG ESSLYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acrolein 2,4-Dinitrophenylhydrazone-d3
TRC-A191222-5MG 5 mg

Acrolein 2,4-Dinitrophenylhydrazone-d3

Sign In for Pricing
View Details
RORC Polyclonal Antibody
E-AB-32827-01 20 µL

RORC Polyclonal Antibody

Sign In for Pricing
View Details
RORC Polyclonal Antibody
E-AB-32827-02 60 µL

RORC Polyclonal Antibody

Sign In for Pricing
View Details
RORC Polyclonal Antibody
E-AB-32827-03 120 µL

RORC Polyclonal Antibody

Sign In for Pricing
View Details
RORC Polyclonal Antibody
E-AB-32827-04 200 µL

RORC Polyclonal Antibody

Sign In for Pricing
View Details
GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2391), 0.2mg/mL
BNUB2391-100 1x 100 µL

GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2391), 0.2mg/mL

Sign In for Pricing
View Details