Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proline-rich transmembrane protein 1 (PRRT1)

This Recombinant Human Proline-rich transmembrane protein 1 (PRRT1) spans the amino acid sequence from region 1-306.

Product Specifications

Product Name Alternative

Proline-rich transmembrane protein 1

UniProt

Q99946

Expression Region

1-306

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSEKSGLPDSVPHTSPPPYNAPQPPAEPPAPPPQAAPSSHHHHHHHYHQSGTATLPRLG AGGLASSAATAQRGPSSSATLPRPPHHAPPGPAAGAPPPGCATLPRMPPDPYLQETRFEG PLPPPPPAAAAPPPPAPAQTAQAPGFVVPTHAGTVGTLPLGGYVAPGYPLQLQPCTAYVP VYPVGTPYAGGTPGGTGVTSTLPPPPQGPGLALLEPRRPPHDYMPIAVLTTICCFWPTGI IAIFKAVQVRTALARGDMVSAEIASREARNFSFISLAVGIAAMVLCTILTVVIIIAAQHH ENYWDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FGF-2 Recombinant Rabbit Monoclonal Antibody [PSH02-09] - BSA and Azide free (Detector)
HA721781 100 µL

Human FGF-2 Recombinant Rabbit Monoclonal Antibody [PSH02-09] - BSA and Azide free (Detector)

Sign In for Pricing
View Details
NPAS3 Human Gene Knockout Kit (CRISPR)
KN415493 1 Kit

NPAS3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Mouse CD30 Ligand/TNFSF8 Protein (His Tag)
PDMM100183-01 20 µg

Recombinant Mouse CD30 Ligand/TNFSF8 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse CD30 Ligand/TNFSF8 Protein (His Tag)
PDMM100183-02 100 µg

Recombinant Mouse CD30 Ligand/TNFSF8 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse CD30 Ligand/TNFSF8 Protein (His Tag)
PDMM100183-03 500 µg

Recombinant Mouse CD30 Ligand/TNFSF8 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse CD30 Ligand/TNFSF8 Protein (His Tag)
PDMM100183-04 1 mg

Recombinant Mouse CD30 Ligand/TNFSF8 Protein (His Tag)

Sign In for Pricing
View Details